Thioredoxin-1 (E. coli)


Description
Symbol

trxA

Organism
Escherichia coli
AA Seq
MSDKIIHLTDDSFDTDVLKA
DGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Outside Data
Repository Accession Number
GenBank-Protein AAA24693.1
UniProtKB P0AA25