SUMO (yeast)


Description
Symbol

SMT3

Organism
Saccharomyces cerevisiae
Molecular Weight
11,597 Da
AA Seq
MSDSEVNQEAKPEVKPEVKP
ETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY
Outside Data
Repository Accession Number Note
GenBank-Protein AAB01675.1
UniProtKB Q12306
Gene Ontology Consortium SGD:S000002918
SGD Saccharomyces Genome Database S000002918 YDR510W
PDB Protein Databank 3V61