SlyD


Description
Symbol

SlyD

Other Names
FKBP-type peptidyl-prolyl cis-trans isomerase
Organism
Escherichia coli
Molecular Weight
20,853 Da
AA Seq
MKVAKDLVVSLAYQVRTEDG
VLVDESPVSAPLDYLHGHGSLISGLETALEGHEVGDKFDV AVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAETDQGPVPVEITAVEDDHVVVD GNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHHHDHDHDGCCGGHGHDHGHEHG GEGCCGGKGNGGCGCH
Outside Data
Repository Accession Number
UniProtKB P0A9K9
PDB Protein Databank 2K8I
PortEco slyD