DsRed


Description
Organism
Discosoma striata
Molecular Weight
25,385 Da
AA Seq
MANTEDVIKEFMQFKVRMEG
SVNGHYFEIEGEGEGKPYEGTQTAKLQVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYMKLSFPEGFTWERSMNFEDGGVVEVQQDSSLQDGTFIYKVKFKGVNFPADGPVMQKKTAGWEPSTEKLYPQDGVLKGEISHALKLKDGGHYTCDFKTVYKAKKPVQLPGNHYVDSKLDITNHNEDYTVVEQYEHAEARHSGSQ
Outside Data
Repository Accession Number
GenBank-Protein ACF35425.1
PDB Protein Databank 1ZGO
UniProtKB Q2WG74