CFP


Description
Other Names
Blue Fluorescent Protein
Organism
Aequorea victoria
Molecular Weight
28,979 Da
AA Seq
SGGEELFAGIVPVLIELDGD
VHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR
Outside Data
Repository Accession Number
GenBank-Protein ADK12945.1