mCherry

Description
Organism
Discosoma striata
Molecular Weight
26,722 Da
AA Seq
MVSKGEEDNMAIIKEFMRFK
VHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLP FAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQD GEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Outside Data 

Repository Accession Number
GenBank-Protein AAV52164.1
GenBank-Protein AIJ27453.1